Side by side

Compare compounds

Add up to three compounds with the compare button on any library card or compound page.

Swipe the table sideways to see every compound.

Attribute	Cagrilintide Get updates
Category	Metabolic
Evidence grade	A Human trial evidence
Regulatory status	Investigational
Human amounts	Trial dosesDosing reference Study durations
Format	Lyophilized vial
Type	Single compound
Molecular formula	C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular weight	4,409 g/mol
CAS number	1415456-99-3
Sequence	(C20 diacid-gamma-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (lipidated N-terminus; disulfide between the two Cys residues; PubChem sequence string XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP)
References	16
Summary	Cagrilintide is an investigational long-acting, lipidated analogue of the pancreatic hormone amylin that acts at amylin and calcitonin receptors and is given by once-weekly subcutaneous injection in clinical trials. It has been studied alone in a phase 2 weight-management trial and, most extensively, in combination with semaglutide (CagriSema) in phase 3 trials, with gastrointestinal events the most commonly reported adverse events. It is not approved by the FDA, and this entry summarizes published and registered trials for research reference only.