Side by side
Compare compounds
Add up to three compounds with the compare button on any library card or compound page.
Swipe the table sideways to see every compound.
| Attribute |  |
|---|---|
| Category | Hormonal |
| Evidence grade | A Human trial evidence |
| Regulatory status | FDA-approved |
| Human amounts | FDA labelDosing reference Study durations |
| Format | |
| Type | Single compound |
| Molecular formula | C164H252N44O55S |
| Molecular weight | 3,752.1 g/mol |
| CAS number | 197922-42-2 |
| Sequence | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| References | 5 |
| Summary | Teduglutide is a 33-amino-acid GLP-2 analog, FDA-approved since 2012 as Gattex for adults and children aged 1 year and older with short bowel syndrome who depend on parenteral support. |